PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03799.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 245aa    MW: 28280 Da    PI: 7.4982
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03799.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM100.42.5e-31158853127
                      NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                              +e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v+  +++l+g++ktLvfy+grap+g+k+dW++hey 
  Rsa1.0_03799.1_g00001.1  15 EEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYL-NSKLIGMRKTLVFYRGRAPNGQKSDWIIHEYY 88 
                              4678**************************************.999***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.9531111IPR003441NAC domain
SuperFamilySSF1019418.37E-3515111IPR003441NAC domain
PfamPF023651.9E-131887IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MILDTRVERC RIGYEEQNEW YFFSHKDKKY PTGTRTNRAT MAGFWKATGR DKAVYLNSKL  60
IGMRKTLVFY RGRAPNGQKS DWIIHEYYSL ESHQNAPPQE EGWVVCRAFK KRTTTVPTKR  120
RQLWDPNCFL YDDATLLEPL DKNVLTKRAK HNTDGLAVTP FKQELPFEAN QIVDDGLFGS  180
MYLKSMGDDE LSQLPQLESP SLASEKLSET ISRAGEDEVG AEKRMTDWRA LDKFVASQFL  240
MSGEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-291711573172NAC domain-containing protein 19
3swp_C2e-291711573172NAC domain-containing protein 19
3swp_B2e-291711573172NAC domain-containing protein 19
3swp_A2e-291711573172NAC domain-containing protein 19
3swm_D2e-291711573172NAC domain-containing protein 19
3swm_C2e-291711573172NAC domain-containing protein 19
3swm_B2e-291711573172NAC domain-containing protein 19
3swm_A2e-291711573172NAC domain-containing protein 19
4dul_B2e-291711570169NAC domain-containing protein 19
4dul_A2e-291711570169NAC domain-containing protein 19
1ut7_B2e-291711570169NO APICAL MERISTEM PROTEIN
1ut7_A2e-291711570169NO APICAL MERISTEM PROTEIN
1ut4_B2e-291711570169NO APICAL MERISTEM PROTEIN
1ut4_A2e-291711570169NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00590DAPTransfer from AT5G66300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382780.0KF738278.1 Brassica napus NAC transcription factor 105 (NAC105.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302610.11e-168NAC domain-containing protein 105-like
SwissprotQ9FH591e-134NC105_ARATH; NAC domain-containing protein 105
TrEMBLA0A0A7DNJ51e-168A0A0A7DNJ5_BRANA; NAC transcription factor 105
STRINGBra012065.1-P1e-166(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151341619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66300.11e-114NAC domain containing protein 105